Protein Info for BNILDI_16580 in Escherichia coli ECRC62

Name: sufS
Annotation: cysteine desulfurase SufS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to SUFS_ECO45: Cysteine desulfurase (sufS) from Escherichia coli O45:K1 (strain S88 / ExPEC)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 100% identity to eco:b1680)

MetaCyc: 100% identical to L-cysteine desulfurase (Escherichia coli K-12 substr. MG1655)
Selenocysteine lyase. [EC: 4.4.1.16]; Cysteine desulfurase. [EC: 4.4.1.16, 2.8.1.7]

Predicted SEED Role

No annotation

MetaCyc Pathways

superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
molybdopterin biosynthesis (6/6 steps found)
thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
superpathway of L-alanine biosynthesis (4/4 steps found)
superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
L-alanine biosynthesis III (1/1 steps found)
L-cysteine degradation IV (1/1 steps found)
thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)
bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
[2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)
tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>BNILDI_16580 cysteine desulfurase SufS (Escherichia coli ECRC62)
MTFSVDKVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHT
LSAQATEKMENVRKRASLFINARSAEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQ
MEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTLFDEKTRLLAITHVSNVLGTE
NPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKE
ALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLN
NIAEYEQNLMHYALSQLESVPDLTLYGPQNRLGVIAFNLGKHHAYDVGSFLDNYGIAVRT
GHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRIHRLLG