Protein Info for BNILDI_16425 in Escherichia coli ECRC62

Annotation: phage baseplate assembly protein V

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01644: phage baseplate assembly protein V
  • amino acids 1 to 186 (186 residues), 174.5 bits, E=9.2e-56
• PF04717: Phage_base_V
  • amino acids 9 to 76 (68 residues), 51.5 bits, E=1.6e-17
• PF18715: Phage_spike
  • amino acids 113 to 165 (53 residues), 82 bits, E=3.5e-27
• PF18946: Apex
  • amino acids 166 to 188 (23 residues), 29.4 bits, see alignment (E = 1e-10)

Best Hits

Swiss-Prot: 46% identical to SPIKE_BPP2: Spike protein (V) from Escherichia phage P2

KEGG orthology group: None (inferred from 96% identity to cro:ROD_36651)

Predicted SEED Role

"Baseplate assembly protein V"

Protein Sequence (188 amino acids)

>BNILDI_16425 phage baseplate assembly protein V (Escherichia coli ECRC62)
MRLLSNIIRTGIISEVDEKSWCVRVLSGGLETGWLRWNTTRAGAFNVWLPPSVGEQVAIA
CIGGNPETAMIIGSLWSDDIPAPGKSLKEIVVSAPDGAVFRYDADAGALSASGMKTATLQ
ASVSVKLDTPVVECTNLLKTAEIDVTKGGKMSGNITHSGGNFTSNGITVHTHKHGGVKGG
SDSTGGPQ