Protein Info for BNILDI_16285 in Escherichia coli ECRC62

Name: chbG
Annotation: chitin disaccharide deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF04794: YdjC" amino acids 5 to 240 (236 residues), 198.9 bits, see alignment E=7.6e-63

Best Hits

Swiss-Prot: 100% identical to CHBG_ECO24: Chitooligosaccharide deacetylase (chbG) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K03478, hypothetical protein (inferred from 96% identity to ecp:ECP_1679)

MetaCyc: 93% identical to chitooligosaccharide monodeacetylase ChbG (Escherichia coli K-12 substr. MG1655)
3.5.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>BNILDI_16285 chitin disaccharide deacetylase (Escherichia coli ECRC62)
MERLLIVNADDFGLSKGQNYGIIEACRNGIVTSTTALVNGQAIDHAVQLSRDEPSLAIGM
HFVLTMGKPLTAMPGLTRDGVLGKWIWQLAEEDALPLEEITQELASQYLRFIELFGRKPT
HLDSHHHVHMFPQIFPIVARFAAEEGIALRIDRQPLSNAGDLPANLRSSQGFSSAFYGEE
ISEALFLQVLDDASHRGDRSLEVMCHPAFIDNTIRQSAYCFPRLTELEVLTSASLKYAIA
ERGYRLGSYLNV