Protein Info for BNILDI_15730 in Escherichia coli ECRC62

Name: pphA
Annotation: protein-serine/threonine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00149: Metallophos" amino acids 18 to 188 (171 residues), 56.4 bits, see alignment E=3e-19

Best Hits

Swiss-Prot: 100% identical to PRP1_ECOLI: Serine/threonine-protein phosphatase 1 (pphA) from Escherichia coli (strain K12)

KEGG orthology group: K07313, serine/threonine protein phosphatase 1 [EC: 3.1.3.16] (inferred from 100% identity to eco:b1838)

MetaCyc: 100% identical to phosphoprotein phosphatase 1 (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]; Phosphoprotein phosphatase. [EC: 3.1.3.48, 3.1.3.16]

Predicted SEED Role

"Ren protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.16, 3.1.3.48

Use Curated BLAST to search for 3.1.3.16 or 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>BNILDI_15730 protein-serine/threonine phosphatase (Escherichia coli ECRC62)
MKQPAPVYQRIAGHQWRHIWLSGDIHGCLEQLRRKLWHCGFDPWRDLLISVGDVIDRGPQ
SLRCLQLLEQHWVCAVRGNHEQMAMDALASQQMSLWLMNGGDWFIALADNQQKQAKTALE
KCQHLPFILEVHSRTGKHVIAHADYPDDVYEWQKDVDLHQVLWSRSRLGERQKGQGITGA
DHFWFGHTPLRHRVDIGNLHYIDTGAVFGGELTLVQLQ