Protein Info for BNILDI_15045 in Escherichia coli ECRC62

Name: yedQ
Annotation: cellulose biosynthesis regulator YedQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details PF17151: CHASE7" amino acids 41 to 227 (187 residues), 315.6 bits, see alignment E=1e-98 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 394 to 560 (167 residues), 210.5 bits, see alignment E=6.5e-67 PF00990: GGDEF" amino acids 398 to 557 (160 residues), 160.4 bits, see alignment E=3.2e-51

Best Hits

Swiss-Prot: 100% identical to DGCQ_ECOUT: Probable diguanylate cyclase DgcQ (dgcQ) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: None (inferred from 99% identity to ecl:EcolC_1687)

MetaCyc: 99% identical to diguanylate cyclase DgcQ (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"FIG00638997: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>BNILDI_15045 cellulose biosynthesis regulator YedQ (Escherichia coli ECRC62)
VQHETKMENQSWLKKLARRLGPGHVVNLCFIVVLLFSTLLTWREVVVLEDAYISSQRNHL
ENVANALDKHLQYNVDKLIFLRNGMREALVAPLDFTSLRNAVTEFEQHRDEHAWQIELNR
RRTLPVNGVSDALVSEGNLLSRENESLDNEITAALEVGYLLRLAHNSSSMVEQAMYVSRA
GFYVSTQPTLFTRNVPTRYYGYVTQPWFIGHSQRENRHRAVRWFTSQPEHASNTEPQVTV
SVPVDSNNYWYGVLGMSIPVRTMQQFLRNAIDKNLDGEYQLYDSKLRFLTSSNPDHPTGN
IFDPRELALLAQAMEHDTRGGIRMDSRYVSWERLDHFDGVLVRVHTLSEGVRGDFGSISI
ALTLLWALFTTMLLISWYVIRRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLA
KLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEE
FCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQ
SLADRRLYLAKQAGRNRVCASDNA