Protein Info for BNILDI_14950 in Escherichia coli ECRC62
Name: mtfA
Annotation: DgsA anti-repressor MtfA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to MTFA_ECO8A: Protein MtfA (mtfA) from Escherichia coli O8 (strain IAI1)
KEGG orthology group: K09933, hypothetical protein (inferred from 99% identity to eco:b1976)MetaCyc: 99% identical to Mlc titration factor (Escherichia coli K-12 substr. MG1655)
3.4.11.-
Predicted SEED Role
"FIG01220476: hypothetical protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (265 amino acids)
>BNILDI_14950 DgsA anti-repressor MtfA (Escherichia coli ECRC62) MIKWPWKVQESAHQTALPWQEALSIPLLTCLTEQEQSKLVTLAERFLQQKRLVPLQGFEL DSLRSCRIALLFCLPVLELGLEWLDGFHEVLIYPAPFVVDDEWEDDIGLVHNQRIVQSGQ SWQQGPIVLNWLDIQDSFDASGFNLIIHEVAHKLDTRNGDRASGVPFIPLREVAGWEHDL HAAMNNIQEEIELVGENAASIDAYAASDPAECFAVLSEYFFSAPELFAPRFPSLWQRFCQ FYQQDPLQRLHRTNDTDSFSATNVH