Protein Info for BNILDI_14680 in Escherichia coli ECRC62

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 228 to 249 (22 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 7 to 190 (184 residues), 35.7 bits, see alignment E=1.2e-12 PF00535: Glycos_transf_2" amino acids 9 to 152 (144 residues), 82.3 bits, see alignment E=6.1e-27 PF10111: Glyco_tranf_2_2" amino acids 25 to 211 (187 residues), 38.1 bits, see alignment E=1.9e-13

Best Hits

Swiss-Prot: 49% identical to WBNJ_ECOLX: O-antigen biosynthesis glycosyltransferase WbnJ (wbnJ) from Escherichia coli

KEGG orthology group: None (inferred from 52% identity to ecg:E2348C_2172)

MetaCyc: 52% identical to [UDP-Gal:alpha-D-GalNAc-(1->3)-alpha-D-GalNAc-PP-Und beta-(1,3)-galactosyltransferase (Escherichia coli O127)
Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase. [EC: 2.4.1.122]; 2.4.1.122 [EC: 2.4.1.122]

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.122

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>BNILDI_14680 glycosyl transferase (Escherichia coli ECRC62)
VSGNKLISIIMASNKIDEFLPLAINSILEQTYQNIEVIFVANGDKAHCISLYIKNFFKDE
RIKIYETPIGQLSHALNLAISNASGDYIARMDADDISLPERLTKQLEYLRSHNLDMVGSD
IIHIDTNGEVIGIKHYPKGLNKINKQLYFRNTFSHSTILIKKKILISARGYNAGFNSEDY
DLWLRLRRKNIKWDNMEECLLKYRIHSASTQRKRLGYAEVAGYSLREFLLRFSFIGIFSV
LIHIVKVYIKSSSHEE