Protein Info for BNILDI_14640 in Escherichia coli ECRC62

Name: wcaK
Annotation: colanic acid biosynthesis pyruvyl transferase WcaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR04006: colanic acid biosynthesis pyruvyl transferase WcaK" amino acids 1 to 426 (426 residues), 933.5 bits, see alignment E=7.4e-286 PF04230: PS_pyruv_trans" amino acids 13 to 356 (344 residues), 140.8 bits, see alignment E=4.3e-45

Best Hits

Swiss-Prot: 99% identical to WCAK_ECOLI: Colanic acid biosynthesis protein WcaK (wcaK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2045)

MetaCyc: 99% identical to colanic acid biosynthesis pyruvyl transferase WcaK (Escherichia coli K-12 substr. MG1655)
2.5.1.-

Predicted SEED Role

"Colanic acid biosysnthesis protein WcaK" in subsystem Colanic acid biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>BNILDI_14640 colanic acid biosynthesis pyruvyl transferase WcaK (Escherichia coli ECRC62)
MKLLILGNHTCGNRGDSAILRGLLDAINILNPHAEVDVMSRYPVSSSWLLNRPVMGDPLF
LQMKQHNSAAGVVGRVKKVLRRRYQHQVLLSRVTDTGKLRNIAIAQGFTDFVRLLSGYDA
IIQVGGSFFVDLYGVPQFEHALCTFMAKKPLFMIGHSVGPFQDEQFNQLANYVFGHCDAL
ILRESVSLDLMKRSNITTAKVEHGVDTAWLVDHHTEDFTASYAVQHWLDVAAQQKTVAIT
LRELAPFDKRLGTTQQAYEKAFAGVVNRILDEGYQVIALSTCTGIDSYNKDDRMVALNLR
QHISDPARYHVVMDELNDLEMGKILEACELTVGTRLHSAIISMNFATPAIAINYEHKSAG
IMQQLGLPEMAIDIRHLLDGSLQAMVADTLGQLPALNTRLSEAVSRERQTGMQMVQSVLE
RIGEVK