Protein Info for BNILDI_13820 in Escherichia coli ECRC62

Name: yejO
Annotation: Putative uncharacterized outer membrane protein YejO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 PF16168: AIDA" amino acids 167 to 228 (62 residues), 83.8 bits, see alignment 1.1e-27 amino acids 240 to 298 (59 residues), 76.8 bits, see alignment 1.6e-25 TIGR04415: autotransporter passenger strand-loop-strand repeat" amino acids 181 to 217 (37 residues), 27.2 bits, see alignment 3.1e-10 amino acids 200 to 232 (33 residues), 21.2 bits, see alignment (E = 2.3e-08) PF03212: Pertactin" amino acids 414 to 538 (125 residues), 151.4 bits, see alignment E=1.6e-48 TIGR01414: outer membrane autotransporter barrel domain" amino acids 439 to 771 (333 residues), 302.4 bits, see alignment E=6e-94 PF03797: Autotransporter" amino acids 585 to 770 (186 residues), 124.6 bits, see alignment E=9.2e-40

Best Hits

Swiss-Prot: 97% identical to YEJO_ECOLI: Putative uncharacterized outer membrane protein YejO (yejO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ecy:ECSE_2459)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (771 amino acids)

>BNILDI_13820 Putative uncharacterized outer membrane protein YejO (Escherichia coli ECRC62)
VATALYSPIALASTVEYGETVDGVVLEKDIQLVYGTANNTKINPGGEQHIKEFGVSSNTE
IKGGYQYIEMNGTAEYSVLNDGYQIVQMGGAANQTTLNNGVLQVYGAANDPTIKGGRLIV
EKDGITVLAAIEKGGLLEVKEGGLAIAVDQKAGGAIKASTRVMEAFGTNRLGQFEIKNGI
ANNMLLENGGSLRVEENDFAYNTTVDSGGLLEVMDGGTVTGVDKKAGGKLIVSTNALEVS
GTNSKGQFSIKDGVSKNYELDDGSGLIVMEDTQAIDTILDEHATMQSLGKDTGTKVQANA
VYDLGRSDQNGSITYSSKAISENMVINNGRANVWAGTMVNVSVRGNDGILEVMKPQINYA
PAMLVGKVVVSEGASFRTHGAVDTSKADVSLENSVWTIIADITTTNQNTLLNLANLAMSD
ANVIMMDEPVTRSSVTASAENFITLTTNTLSGNGNFYMRTDMANHQSDQLNATGQATGDF
KIFVTDTGASPAAGDSLTLVTTGGGDAAFTLGNAGGVVDIGTYEYTLLDNGNHSWSLAEN
RAQITPSTTDVLNMAAAQPLVFDAELDTMRERLGSVKGVNYDTAMWSSAINTRNNVTTDA
GAGFEQTLTGLTLGIDSRFSREETSTIRGLFFGYSHSDIGFDRGGKGNVDSYTLGAYAGW
EHQNGAYVDGVVKVDRFANTIHCKMSNGATAFGDYNSNGAGAHVESGFRWVDGLWSVRPY
LAFTGFTTDGQDYTLSNGMRADVGNTRILRAEAGTAVSYHMDLQNGTTLEP