Protein Info for BNILDI_13780 in Escherichia coli ECRC62

Name: ccmB
Annotation: heme exporter protein CcmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 87 to 111 (25 residues), see Phobius details amino acids 124 to 150 (27 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details PF03379: CcmB" amino acids 3 to 217 (215 residues), 315.1 bits, see alignment E=1e-98 TIGR01190: heme exporter protein CcmB" amino acids 6 to 216 (211 residues), 316.9 bits, see alignment E=3.1e-99

Best Hits

Swiss-Prot: 100% identical to CCMB_ECO57: Heme exporter protein B (ccmB) from Escherichia coli O157:H7

KEGG orthology group: K02194, heme exporter protein B (inferred from 100% identity to eco:b2200)

MetaCyc: 100% identical to cytochrome c maturation protein B (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>BNILDI_13780 heme exporter protein CcmB (Escherichia coli ECRC62)
MMFWRIFRLELRVAFRHSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALL
SSLLALERLFRDDLQDGSLEQLMLLPLPLPAVVLAKVMAHWMVTGLPLLILSPLVAMLLG
MDVYGWQVMALTLLLGTPTLGFLGAPGVALTVGLKRGGVLLSILVLPLTIPLLIFATAAM
DAASMHLPVDGYLAILGALLAGTATLSPFATAAALRISIQ