Protein Info for BNILDI_12980 in Escherichia coli ECRC62

Name: emrY
Annotation: multidrug efflux MFS transporter permease subunit EmrY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 10 to 11 (2 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 369 to 393 (25 residues), see Phobius details amino acids 484 to 502 (19 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 19 to 502 (484 residues), 571.3 bits, see alignment E=8.6e-176 PF07690: MFS_1" amino acids 23 to 418 (396 residues), 177.9 bits, see alignment E=2.9e-56 PF06609: TRI12" amino acids 31 to 283 (253 residues), 28 bits, see alignment E=7.8e-11

Best Hits

Swiss-Prot: 100% identical to EMRY_ECOLI: Probable multidrug resistance protein EmrY (emrY) from Escherichia coli (strain K12)

KEGG orthology group: K07786, MFS transporter, multidrug resistance protein Y (inferred from 100% identity to eco:b2367)

MetaCyc: 100% identical to tripartite efflux pump membrane subunit EmrY (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>BNILDI_12980 multidrug efflux MFS transporter permease subunit EmrY (Escherichia coli ECRC62)
MAITKSTPAPLTGGTLWCVTIALSLATFMQMLDSTISNVAIPTISGFLGASTDEGTWVIT
SFGVANAIAIPVTGRLAQRIGELRLFLLSVTFFSLSSLMCSLSTNLDVLIFFRVVQGLMA
GPLIPLSQSLLLRNYPPEKRTFALALWSMTVIIAPICGPILGGYICDNFSWGWIFLINVP
MGIIVLTLCLTLLKGRETETSPVKMNLPGLTLLVLGVGGLQIMLDKGRDLDWFNSSTIII
LTVVSVISLISLVIWESTSENPILDLSLFKSRNFTIGIVSITCAYLFYSGAIVLMPQLLQ
ETMGYNAIWAGLAYAPIGIMPLLISPLIGRYGNKIDMRLLVTFSFLMYAVCYYWRSVTFM
PTIDFTGIILPQFFQGFAVACFFLPLTTISFSGLPDNKFANASSMSNFFRTLSGSVGTSL
TMTLWGRRESLHHSQLTATIDQFNPVFNSSSQIMDKYYGSLSGVLNEINNEITQQSLSIS
ANEIFRMAAIAFILLTVLVWFAKPPFTAKGVG