Protein Info for BNILDI_12465 in Escherichia coli ECRC62

Name: narQ
Annotation: nitrate/nitrite two-component system sensor histidine kinase NarQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details PF13675: PilJ" amino acids 32 to 127 (96 residues), 76.2 bits, see alignment E=4.3e-25 PF00672: HAMP" amino acids 172 to 223 (52 residues), 50.6 bits, see alignment 4e-17 PF07730: HisKA_3" amino acids 361 to 424 (64 residues), 62.7 bits, see alignment E=7.9e-21 PF02518: HATPase_c" amino acids 467 to 556 (90 residues), 52.9 bits, see alignment E=9.4e-18

Best Hits

Swiss-Prot: 100% identical to NARQ_ECOLI: Nitrate/nitrite sensor protein NarQ (narQ) from Escherichia coli (strain K12)

KEGG orthology group: K07674, two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarQ [EC: 2.7.13.3] (inferred from 100% identity to eco:b2469)

MetaCyc: 100% identical to sensor histidine kinase NarQ (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Nitrate/nitrite sensor protein (EC 2.7.3.-)" in subsystem Nitrate and nitrite ammonification (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (566 amino acids)

>BNILDI_12465 nitrate/nitrite two-component system sensor histidine kinase NarQ (Escherichia coli ECRC62)
VIVKRPVSASLARAFFYIVLLSILSTGIALLTLASSLRDAEAINIAGSLRMQSYRLGYDL
QSGSPQLNAHRQLFQQALHSPVLTNLNVWYVPEAVKTRYAHLNANWLEMNNRLSKGDLPW
YQANINNYVNQIDLFVLALQHYAERKMLLVVAISLAGGIGIFTLVFFTLRRIRHQVVAPL
NQLVTASQRIEHGQFDSPPLDTSLPNELGLLAKTFNQMSSELHKLYLSLEASVEEKTRDL
HEAKRRLEVLYQCSQALNTSQIDVHCFRHILQIVRDNEAAEYLELNVGENWRISEGQPNP
ELPMQILPVTMQETVYGELHWQNSHVSSSEPLLNSVSSMLGRGLYFNQAQKHFQQLLLME
ERATIARELHDSLAQVLSYLRIQLTLLKRSIPEDNATAQSIMADFSQALNDAYRQLRELL
TTFRLTLQQADLPSALREMLDTLQNQTSAKLTLDCRLPTLALDAQMQVHLLQIIREAVLN
AMKHANASEIAVSCVTAPDGNHTVYIRDNGIGIGEPKEPEGHYGLNIMRERAERLGGTLT
FSQPSGGGTLVSISFRSAEGEESQLM