Protein Info for BNILDI_12425 in Escherichia coli ECRC62

Name: ypfH
Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF02230: Abhydrolase_2" amino acids 3 to 209 (207 residues), 201.5 bits, see alignment E=2.3e-63 PF01738: DLH" amino acids 76 to 199 (124 residues), 43.4 bits, see alignment E=4.8e-15

Best Hits

Swiss-Prot: 99% identical to YPFH_ECOLI: Esterase YpfH (ypfH) from Escherichia coli (strain K12)

KEGG orthology group: K06999, (no description) (inferred from 99% identity to eco:b2473)

Predicted SEED Role

"Phospholipase/carboxylesterase family protein (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>BNILDI_12425 esterase (Escherichia coli ECRC62)
MKHDHFVVQSPDKPAQQLLLLFHGVGDNPVAMGEIGSWFAPLFPDALVVSVGGAEPSGNP
AGRQWFSVQGITEDNRQARVDAIMPTFIETVRYWQKQSGVGANATALIGFSQGAIMALES
IKAEPGLASRVIAFNGRYASLPETASTATTIHLIHGGEDPVIDLAHAVAAQEALISAGGD
VTLDIVEDLGHAIDNRSMQFALDHLRYTIPKHYFDEALSGGKPGDDDVIEMM