Protein Info for BNILDI_12285 in Escherichia coli ECRC62

Annotation: DnaA regulatory inactivator Hda

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR03420: DnaA regulatory inactivator Hda" amino acids 21 to 247 (227 residues), 281.2 bits, see alignment E=2.9e-88 PF00308: Bac_DnaA" amino acids 31 to 174 (144 residues), 35 bits, see alignment E=1.7e-12 PF22688: Hda_lid" amino acids 182 to 246 (65 residues), 101.2 bits, see alignment E=2.6e-33

Best Hits

Swiss-Prot: 99% identical to HDA_SALTY: DnaA regulatory inactivator Hda (hda) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10763, DnaA-homolog protein (inferred from 100% identity to ecd:ECDH10B_2662)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>BNILDI_12285 DnaA regulatory inactivator Hda (Escherichia coli ECRC62)
VVNFSRFCEILVEVSLNTPAQLSLPLYLPDDETFASFWPGDNSSLLAALQNVLRQEHSGY
IYLWAREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHLSLVCIDNIE
CIAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPL
SDEDKLQALQLRARLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLDRASITAQRKLTIP
FVKEILKL