Protein Info for BNILDI_12035 in Escherichia coli ECRC62

Name: hcaB
Annotation: 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 9 to 194 (186 residues), 136.8 bits, E=1e-43
• PF13561: adh_short_C2
  • amino acids 16 to 256 (241 residues), 108.6 bits, E=5.7e-35

Best Hits

Swiss-Prot: 100% identical to HCAB_ECO55: 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase (hcaB) from Escherichia coli (strain 55989 / EAEC)

KEGG orthology group: K05711, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase [EC: 1.3.1.-] (inferred from 100% identity to eco:b2541)

MetaCyc: 100% identical to 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase (Escherichia coli K-12 substr. MG1655)
PHENPRODIOLDEHYDROG-RXN [EC: 1.3.1.87]; 1.3.1.87 [EC: 1.3.1.87]

Predicted SEED Role

"2,3-dihydroxy-2,3-dihydro-phenylpropionate dehydrogenase (EC 1.3.1.-)" in subsystem Cinnamic Acid Degradation or Naphtalene and antracene degradation or Phenylpropanoid compound degradation or Phenylpropionate Degradation (EC 1.3.1.-)

MetaCyc Pathways

• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (8/8 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (5/5 steps found)
• cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (5/5 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Fluorene degradation
• Fluorobenzoate degradation
• Isoflavonoid biosynthesis
• Phenylalanine metabolism
• Propanoate metabolism
• Tryptophan metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.- or 1.3.1.87

Protein Sequence (270 amino acids)

>BNILDI_12035 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase (Escherichia coli ECRC62)
MSDLHNESIFITGGGSGLGLALVERFIEEGAQVATLELSAAKVASLRQRFGEHILAVEGN
VTCYADYQRAVDQILTRSGKLDCFIGNAGIWDHNASLVNTPAETLETGFHELFNVNVLGY
LLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPKVRV
NGVGPCGMASDLRGPQALGQSETSIMQSLTPEKIAAILPLQFFPQPADFTGPYVMLASRR
NNRALSGVMINADAGLAIRGIRHVAAGLDL