Protein Info for BNILDI_11535 in Escherichia coli ECRC62

Name: dksA
Annotation: Prokaryotic dksA/traR C4-type zinc finger

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 TIGR02419: phage/conjugal plasmid C-4 type zinc finger protein, TraR family" amino acids 3 to 64 (62 residues), 65.6 bits, see alignment E=2.3e-22 PF01258: zf-dskA_traR" amino acids 33 to 64 (32 residues), 43.7 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 68% identical to CP80_BP186: Uncharacterized 8.5 kDa protein in gpA 5'region (CP80) from Escherichia phage 186

KEGG orthology group: None (inferred from 97% identity to ecz:ECS88_2843)

Predicted SEED Role

"Hypothetical Zinc-finger containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (75 amino acids)

>BNILDI_11535 Prokaryotic dksA/traR C4-type zinc finger (Escherichia coli ECRC62)
MADAMDLVQQRVEEERQRHIRAARAKTPGVSRVLCIECEAPIPPARRRAIPGVQLCITCQ
EIAELKGKHYNGGAV