Protein Info for BNILDI_11045 in Escherichia coli ECRC62

Name: norW
Annotation: NADH:flavorubredoxin reductase NorW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF07992: Pyr_redox_2" amino acids 5 to 275 (271 residues), 182 bits, see alignment E=6.1e-57 PF13738: Pyr_redox_3" amino acids 66 to 251 (186 residues), 48.8 bits, see alignment E=2.1e-16 PF00070: Pyr_redox" amino acids 143 to 217 (75 residues), 61.8 bits, see alignment E=2.5e-20 PF18113: Rbx_binding" amino acids 306 to 375 (70 residues), 70 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 100% identical to NORW_ECO24: Nitric oxide reductase FlRd-NAD(+) reductase (norW) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K12265, nitric oxide reductase FlRd-NAD(+) reductase [EC: 1.18.1.-] (inferred from 100% identity to ecw:EcE24377A_2995)

MetaCyc: 98% identical to NADH:flavorubredoxin reductase (Escherichia coli K-12 substr. MG1655)
Rubredoxin--NAD(+) reductase. [EC: 1.18.1.1]

Predicted SEED Role

"Nitric oxide reductase FlRd-NAD(+) reductase (EC 1.18.1.-)" in subsystem Nitrosative stress (EC 1.18.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.- or 1.18.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>BNILDI_11045 NADH:flavorubredoxin reductase NorW (Escherichia coli ECRC62)
MSNGIVIIGSGFAARQLVKNIRKQDATIPLTLIAADSMDEYNKPDLSHVISQGQRADDLT
RQTAGEFAEQFNLRLFPHTWVTDIDAEARVVKSQNNQWQYGKLVLATGASAFVPPVPGRE
LMLTLNSQQEYRACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASL
MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGILATLDRQRSIEVDAVIAATGLRPE
TALARRAGLTINRGVCVDSYLQTSNDDIYALGDCAEINGQVLPFLQPIQLSAMVLAKNLL
GNNTPLKLPAMLVKIKTPELPLHLAGETQRQDLRWQINTERQGMVARGVDDADQLRAFVV
SEDRMKEAFGLLKTLPM