Protein Info for BNILDI_10685 in Escherichia coli ECRC62

Name: yqcE
Annotation: Inner membrane protein YqcE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 77 to 93 (17 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 214 to 240 (27 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details PF12832: MFS_1_like" amino acids 13 to 143 (131 residues), 25.9 bits, see alignment E=5.6e-10 PF07690: MFS_1" amino acids 22 to 362 (341 residues), 89.9 bits, see alignment E=1.6e-29

Best Hits

Swiss-Prot: 99% identical to YQCE_ECOLI: Inner membrane protein YqcE (yqcE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2775)

Predicted SEED Role

"Inner membrane protein YqcE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>BNILDI_10685 Inner membrane protein YqcE (Escherichia coli ECRC62)
MQHNSYRRWITLAIISFSGGVSFDLAYLRYIYQIPMAKFMGFSNTEIGLIMSTFGIAAII
LYAPSGVIADKFSHRKMITSAMIITGLLGLLMATYPPLWVMLCIQVAFAITTILMLWSVS
IKAASLLGDHSEQGKIMGWMEGLRGVGVMSLAVFTMWVFSRFAPDDSASLKTVIIIYSVV
YILLGILCWFFVSDNNNLRSANNEEKQSFQLSDILAVLRISTTWYCSMVIFGVFTIYAIL
SYSTNYLTEMYGMSLVAASYMGIAINKIFRALCGPLGGIITTYSKVKSPTRVIQILSVLG
LLALTALLVTNSNPQSVAMGIGLILLLGFTCYASRGLYWACPGEARTPSYIMGTTVGICS
VIGFLPDVFVYPIIGHWQDTLPAAEAYRNMWLMGMAALAMVIVFTFLLFQKIRTADSAPA
MASSK