Protein Info for BNILDI_10540 in Escherichia coli ECRC62

Name: fucP
Annotation: L-fucose:H+ symporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 385 to 404 (20 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details TIGR00885: L-fucose:H+ symporter permease" amino acids 24 to 432 (409 residues), 678.2 bits, see alignment E=2.4e-208 PF07690: MFS_1" amino acids 32 to 391 (360 residues), 82 bits, see alignment E=4e-27 PF00083: Sugar_tr" amino acids 59 to 181 (123 residues), 26.7 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 100% identical to FUCP_ECOLI: L-fucose-proton symporter (fucP) from Escherichia coli (strain K12)

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 100% identity to eco:b2801)

MetaCyc: 100% identical to L-fucose:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN0-7221; RXN0-7222; TRANS-RXN-20

Predicted SEED Role

"Fucose permease" in subsystem L-fucose utilization or L-fucose utilization temp

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>BNILDI_10540 L-fucose:H+ symporter permease (Escherichia coli ECRC62)
MGNTSIQTQSYRAVDKDAGQSRSYIIPFALLCSLFFLWAVANNLNDILLPQFQQAFTLTN
FQAGLIQSAFYFGYFIIPIPAGILMKKLSYKAGIITGLFLYALGAALFWPAAEIMNYTLF
LVGLFIIAAGLGCLETAANPFVTVLGPESSGHFRLNLAQTFNSFGAIIAVVFGQSLILSN
VPHQSQDVLDKMSPEQLSAYKHSLVLSVQTPYMIIVAIVLLVALLIMLTKFPALQSDNHS
DAKQGSFSASLSRLARIRHWRWAVLAQFCYVGAQTACWSYLIRYAVEEIPGMTAGFAANY
LTGTMVCFFIGRFTGTWLISRFAPHKVLAAYALIAMALCLISAFAGGHVGLIALTLCSAF
MSIQYPTIFSLGIKNLGQDTKYGSSFIVMTIIGGGIVTPVMGFVSDAAGNIPTAELIPAL
CFAVIFIFARFRSQTATN