Protein Info for BNILDI_10095 in Escherichia coli ECRC62

Name: ygfM
Annotation: Uncharacterized protein YgfM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR03312: probable selenate reductase, FAD-binding subunit" amino acids 2 to 258 (257 residues), 490.1 bits, see alignment E=5.8e-152 PF00941: FAD_binding_5" amino acids 4 to 152 (149 residues), 71.3 bits, see alignment E=4.4e-24

Best Hits

Swiss-Prot: 99% identical to YGFM_ECO57: Uncharacterized protein YgfM (ygfM) from Escherichia coli O157:H7

KEGG orthology group: K12529, putative selenate reductase FAD-binding subunit (inferred from 99% identity to eco:b2880)

Predicted SEED Role

"Uncharacterized protein YgfM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>BNILDI_10095 Uncharacterized protein YgfM (Escherichia coli ECRC62)
MIEQFFRPDSVEQALELKRRYQDEAVWFAGGSKLNATPTRTDKKIAISLQDLELDWVDWD
NGALRIGAMSRLQPLRDARFIPAALREALGFVYSRHVRNQSTIGGEIAARQEESVLLPVL
LALDAELVFGNGETLSIEDYLACPCDRLLTEIIIKDPYRTCATRKISRSQAGLTVVTAAV
AMTDHDGMRIALDGVASKALRLHDVEKQNLEGNALEQAVANAIFPQEDLRGSVAYKRYIS
GVLVADLYADCQQAEEEAV