Protein Info for BNILDI_09810 in Escherichia coli ECRC62

Name: cysA
Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 49 to 61 (13 residues), see Phobius details PF00005: ABC_tran" amino acids 21 to 164 (144 residues), 96.8 bits, see alignment E=1.8e-31

Best Hits

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 96% identity to ecm:EcSMS35_3070)

Predicted SEED Role

"ATPase component STY3233 of energizing module of queuosine-regulated ECF transporter" in subsystem ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>BNILDI_09810 ABC transporter ATP-binding protein (Escherichia coli ECRC62)
MLTLNKISYRWPGAATDCLCDISLQLKQGEWLALTGDNGAGKSTLLRVMAGLLTPTAGTV
MLQQQAMKNLKNRQRAAKVGVLFQEAENQLFHSTVADEIAFGLKLQKCPADEITQRTHAA
LQCCQLADTANAHPLDLHSAQRRMVAVACLEALSPPLLLLDEPSRDFDENWLSVFESWLE
KCGQRGTSVVAISHDAAFTRRHFSRVVRLEDGLIRNVNPPDDIHP