Protein Info for BNILDI_09530 in Escherichia coli ECRC62

Name: zorA
Annotation: Zorya protein ZorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details PF01618: MotA_ExbB" amino acids 52 to 109 (58 residues), 28.4 bits, see alignment 6.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to etw:ECSP_5383)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>BNILDI_09530 Zorya protein ZorA (Escherichia coli ECRC62)
MLAQLFEQLFQSIDSTLITNIFIWAVIFVFLSAWWCDKKNIHSKFREYAPTLMGALGILG
TFIGIIIGLLNFNTESIDTSIPVLLGGLKTAFITSIVGMFFAILFNGMDAFFFANKRSAL
AENNPESVTPEHIYHELKEQNQTLTKLVSGINGDSEGSLIAQIKLLRTEISDSSQAQLAN
HTHFSNKLWEQLEQFADLMAKGATEQIIDALRQVIIDFNENLTEQFGENFKALDASVKKL
VEWQGNYKTQIEQMSEQYQQSVESLVETKTAVAGIWEECKEIPLAMSELREVLQVNQHQI
SELSRHLETFVAIRDKATTVLPEIQNKMAEVGELLKSGAANVSASLEQTSQQILLNADSM
RVALDEGTEGFRQSVTQTQQAFASMAHDVSNSSETLTSTLGETITEMKQSGEEFLKSLES
HSKELHRNMEQNTTNVIDMFSKTGEKINHQLSSNADNMFDSIQTSFDKAGAGLTSQVRES
IEKFALSINEQLHAFEQATEREMNREMQSLGNALLSISKGFVGNYEKLIKDYQIVMGQLQ
ALISANKHRG