Protein Info for BNILDI_09335 in Escherichia coli ECRC62

Name: ubiE
Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF08003: Methyltransf_9" amino acids 29 to 152 (124 residues), 24.5 bits, see alignment E=7.5e-09 PF13489: Methyltransf_23" amino acids 32 to 188 (157 residues), 70.3 bits, see alignment E=9.8e-23 PF01209: Ubie_methyltran" amino acids 37 to 152 (116 residues), 66 bits, see alignment E=2e-21 PF05175: MTS" amino acids 40 to 146 (107 residues), 27 bits, see alignment E=1.8e-09 PF13847: Methyltransf_31" amino acids 45 to 149 (105 residues), 85.5 bits, see alignment E=2e-27 PF03848: TehB" amino acids 46 to 150 (105 residues), 26 bits, see alignment E=3.5e-09 PF05148: Methyltransf_8" amino acids 46 to 155 (110 residues), 30 bits, see alignment E=2.8e-10 PF03141: Methyltransf_29" amino acids 47 to 145 (99 residues), 29.8 bits, see alignment E=1.5e-10 PF13649: Methyltransf_25" amino acids 48 to 141 (94 residues), 83 bits, see alignment E=1.2e-26 PF08242: Methyltransf_12" amino acids 49 to 143 (95 residues), 58.2 bits, see alignment E=7e-19 PF08241: Methyltransf_11" amino acids 49 to 145 (97 residues), 95.5 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 93% identical to YAFE_ECOLI: Uncharacterized protein YafE (yafE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eoi:ECO111_0207)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>BNILDI_09335 SAM-dependent methyltransferase (Escherichia coli ECRC62)
MTTQSHHDHVEKQFSSQACEYLTSTVHASGRDLQRLAVRLADYPGASVLDMGCGAGHASF
VAAQNVSTVVAYDLSAHMLDVVAQAAEVRQLKNITTRQGYAESLPFADNAFDIVISRYSA
HHWHDVGAALREVNRILKPGGRLIVMDVMSPGHPVRDIWLQTVEALRDTSHVRNYASGEW
LTLINEANLIVDNLITDKLPLEFSSWVVRMRTPEALVDAIRIYQQSASTEVRTYFSLQTD
GSFTSDIIMVEAHKAA