Protein Info for BNILDI_07700 in Escherichia coli ECRC62

Name: gntP
Annotation: gluconate permease GntP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 29 to 50 (22 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 91 to 132 (42 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 340 to 373 (34 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 424 to 446 (23 residues), see Phobius details PF02447: GntP_permease" amino acids 5 to 446 (442 residues), 552.1 bits, see alignment E=8.8e-170 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 5 to 446 (442 residues), 605.9 bits, see alignment E=2.5e-186 PF03600: CitMHS" amino acids 27 to 393 (367 residues), 41.4 bits, see alignment E=1e-14

Best Hits

Swiss-Prot: 100% identical to GNTP_ECO57: High-affinity gluconate transporter (gntP) from Escherichia coli O157:H7

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 100% identity to eco:b4321)

MetaCyc: 100% identical to fructuronate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-81; TRANS-RXN0-209

Predicted SEED Role

"Fructuronate transporter GntP" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>BNILDI_07700 gluconate permease GntP (Escherichia coli ECRC62)
MHVLNILWVVFGIGLMLVLNLKFKINSMVALLVAALSVGMLAGMDLMSLLHTMKAGFGNT
LGELAIIVVFGAVIGKLMVDSGAAHQIAHTLLARLGLRYVQLSVIIIGLIFGLAMFYEVA
FIMLAPLVIVIAAEAKIPFLKLAIPAVAAATTAHSLFPPQPGPVALVNAYGADMGMVYIY
GVLVTIPSVICAGLILPKFLGNLERPTPSFLKADQPVDMNNLPSFGVSILVPLIPAIIMI
STTIANIWLVKDTPAWEVVNFIGSSPIAMFIAMVVAFVLFGTARGHDMQWVMNAFESAVK
SIAMVILIIGAGGVLKQTIIDTGIGDTIGMLMSHGNISPYIMAWLITVLIRLATGQGVVS
AMTAAGIISAAILDPATGQLVGVNPALLVLATAAGSNTLTHINDASFWLFKGYFDLSVKD
TLKTWGLLELVNSVVGLIIVLIISMVA