Protein Info for BNILDI_07310 in Escherichia coli ECRC62

Name: fbp
Annotation: class 1 fructose-bisphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00316: FBPase" amino acids 2 to 192 (191 residues), 303.6 bits, see alignment E=5.3e-95 PF18913: FBPase_C" amino acids 197 to 325 (129 residues), 163.9 bits, see alignment E=1.5e-52

Best Hits

Swiss-Prot: 100% identical to F16PA_SHIFL: Fructose-1,6-bisphosphatase class 1 (fbp) from Shigella flexneri

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 100% identity to eco:b4232)

MetaCyc: 100% identical to fructose-1,6-bisphosphatase 1 (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>BNILDI_07310 class 1 fructose-bisphosphatase (Escherichia coli ECRC62)
MKTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGE
VQQKLDLFANEKLKAALKARDIVAGIASEEEDEIVVFEGCEHAKYVVLMDPLDGSSNIDV
NVSVGTIFSIYRRVTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTMLVYTTGCGVHAFTY
DPSLGVFCLCQERMRFPEKGKTYSINEGNYIKFPNGVKKYIKFCQEEDKSTNRPYTSRYI
GSLVADFHRNLLKGGIYLYPSTASHPDGKLRLLYECNPMAFLAEQAGGKASDGKERILDI
IPETLHQRRSFFVGNDHMVEDVERFIREFPDA