Protein Info for BNILDI_06855 in Escherichia coli ECRC62

Name: sugE
Annotation: quaternary ammonium compound efflux SMR transporter SugE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 1 to 93 (93 residues), 115 bits, see alignment E=9.4e-38

Best Hits

Swiss-Prot: 100% identical to GDX_ECO57: Guanidinium exporter (gdx) from Escherichia coli O157:H7

KEGG orthology group: K11741, quaternary ammonium compound-resistance protein SugE (inferred from 100% identity to eco:b4148)

MetaCyc: 100% identical to guanidinium exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-368; TRANS-RXN-369

Predicted SEED Role

"Quaternary ammonium compound-resistance protein SugE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>BNILDI_06855 quaternary ammonium compound efflux SMR transporter SugE (Escherichia coli ECRC62)
MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMKSLPVGTAYA
VWTGIGAVGAAITGIVLLGESANPMRLASLALIVLGIIGLKLSTH