Protein Info for BNILDI_06705 in Escherichia coli ECRC62

Name: dcuB
Annotation: anaerobic C4-dicarboxylate transporter DcuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 89 to 118 (30 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 342 to 392 (51 residues), see Phobius details amino acids 421 to 445 (25 residues), see Phobius details PF03605: DcuA_DcuB" amino acids 6 to 376 (371 residues), 478.2 bits, see alignment E=8.3e-148 TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 6 to 443 (438 residues), 674.2 bits, see alignment E=4.5e-207

Best Hits

Swiss-Prot: 100% identical to DCUB_ECO57: Anaerobic C4-dicarboxylate transporter DcuB (dcuB) from Escherichia coli O157:H7

KEGG orthology group: K07792, anaerobic C4-dicarboxylate transporter DcuB (inferred from 100% identity to eco:b4123)

MetaCyc: 100% identical to anaerobic C4-dicarboxylate transporter DcuB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-106A; TRANS-RXN-106B; TRANS-RXN-299; TRANS-RXN0-499

Predicted SEED Role

"C4-dicarboxylate transporter DcuB"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>BNILDI_06705 anaerobic C4-dicarboxylate transporter DcuB (Escherichia coli ECRC62)
MLFTIQLIIILICLFYGARKGGIALGLLGGIGLVILVFVFHLQPGKPPVDVMLVIIAVVA
ASATLQASGGLDVMLQIAEKLLRRNPKYVSIVAPFVTCTLTILCGTGHVVYTILPIIYDV
AIKNNIRPERPMAASSIGAQMGIIASPVSVAVVSLVAMLGNVTFDGRHLEFLDLLAITIP
STLIGILAIGIFSWFRGKDLDKDEEFQKFISVPENREYVYGDTATLLDKKLPKSNWLAMW
IFLGAIAVVALLGADSDLRPSFGGKPLSMVLVIQMFMLLTGALIIILTKTNPASISKNEV
FRSGMIAIVAVYGIAWMAETMFGAHMSEIQGVLGEMVKEYPWAYAIVLLLVSKFVNSQAA
ALAAIVPVALAIGVDPAYIVASAPACYGYYILPTYPSDLAAIQFDRSGTTHIGRFVINHS
FILPGLIGVSVSCVFGWIFAAMYGFL