Protein Info for BNILDI_06555 in Escherichia coli ECRC62

Name: phnM
Annotation: alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR02318: phosphonate metabolism protein PhnM" amino acids 2 to 378 (377 residues), 554.1 bits, see alignment E=7.3e-171 PF01979: Amidohydro_1" amino acids 75 to 376 (302 residues), 35.1 bits, see alignment E=9.1e-13 PF07969: Amidohydro_3" amino acids 141 to 378 (238 residues), 48.9 bits, see alignment E=7.4e-17

Best Hits

Swiss-Prot: 98% identical to PHNM_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (phnM) from Escherichia coli (strain K12)

KEGG orthology group: K06162, PhnM protein (inferred from 100% identity to eoi:ECO111_4966)

MetaCyc: 98% identical to RPnTP hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-17955 [EC: 3.6.1.63]; 3.6.1.63 [EC: 3.6.1.63]

Predicted SEED Role

"Metal-dependent hydrolase involved in phosphonate metabolism" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>BNILDI_06555 alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (Escherichia coli ECRC62)
MIINNVKLVLENEVVHGSLEVQDGEIRAFAESQSRLPEAMDGEGGWLLPGLIELHTDNLD
KFFTPRPKVDWPAHSAMSSHDALMVASGITTVLDAVAIGDVRDGGDRLENLEKMINAIEE
TQKRGVNRAEHRLHLRCELPHHTTLPLFEKLVQREPVTLVSLMDHSPGQRQFANREKYRE
YYQGKYSLTDAQMQQYEEEQLALAARWSQPNRESIAALCHARQIALASHDDATHAHVAES
HQLGSVIAEFPTTFEAAEASRKHGMNVLMGAPNIVRGGSHSGNVAASELAQLGLLDILSS
DYYPASLLDAAFRVADDESNRFTLPQAVRLVTKNPAQALNLQDRGVIGEGKRADLVLAHR
QGNHIHIDHVWRQGKRVF