Protein Info for BNILDI_06135 in Escherichia coli ECRC62

Name: iclR
Annotation: glyoxylate bypass operon transcriptional repressor IclR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF09339: HTH_IclR" amino acids 26 to 76 (51 residues), 68 bits, see alignment 4.8e-23 PF01614: IclR_C" amino acids 95 to 266 (172 residues), 166.1 bits, see alignment E=6e-53

Best Hits

Swiss-Prot: 100% identical to ICLR_ECOLI: Transcriptional repressor IclR (iclR) from Escherichia coli (strain K12)

KEGG orthology group: K13641, IclR family transcriptional regulator, acetate operon repressor (inferred from 100% identity to eco:b4018)

Predicted SEED Role

"Acetate operon repressor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>BNILDI_06135 glyoxylate bypass operon transcriptional repressor IclR (Escherichia coli ECRC62)
MVAPIPAKRGRKPAVATAPATGQVQSLTRGLKLLEWIAESNGSVALTELAQQAGLPNSTT
HRLLTTMQQQGFVRQVGELGHWAIGAHAFMVGSSFLQSRNLLAIVHPILRNLMEESGETV
NMAVLDQSDHEAIIIDQVQCTHLMRMSAPIGGKLPMHASGAGKAFLAQLSEEQVTKLLHR
KGLHAYTHATLVSPVHLKEDLAQTRKRGYSFDDEEHALGLRCLAACIFDEHREPFAAISI
SGPISRITDDRVTEFGAMVIKAAKEVTLAYGGMR