Protein Info for BNILDI_06095 in Escherichia coli ECRC62

Name: yjaB
Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF00583: Acetyltransf_1" amino acids 34 to 122 (89 residues), 46.9 bits, see alignment E=4.7e-16 PF13673: Acetyltransf_10" amino acids 42 to 130 (89 residues), 54.5 bits, see alignment E=1.8e-18 PF13508: Acetyltransf_7" amino acids 51 to 123 (73 residues), 49.8 bits, see alignment E=5.7e-17

Best Hits

Swiss-Prot: 97% identical to YJAB_ECOLI: Peptidyl-lysine N-acetyltransferase YjaB (yjaB) from Escherichia coli (strain K12)

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 97% identity to eco:b4012)

MetaCyc: 97% identical to peptidyl-lysine N-acetyltransferase YjaB (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Putative acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>BNILDI_06095 acetyltransferase (Escherichia coli ECRC62)
MVISIRRSQHEEGEELVAIWCRSVDATHDFLSAEYRAELEELVRSFLPEAPLWVAVNERD
QPVGFMLLSGQHMDALFIDPDVRGCGVGRMLVEHALSMAPELTTNVNEQNEQAVGFYKKV
GFKVTGRSEVDDLGKPYPLLNLAYVGE