Protein Info for BNILDI_05705 in Escherichia coli ECRC62

Name: metJ
Annotation: met regulon transcriptional regulator MetJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF01340: MetJ" amino acids 26 to 105 (80 residues), 169 bits, see alignment E=8.9e-55

Best Hits

Swiss-Prot: 100% identical to METJ_SHIDS: Met repressor (metJ) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K03764, transcriptional repressor of met regulon (beta-ribbon, MetJ family) (inferred from 100% identity to eco:b3938)

Predicted SEED Role

"Methionine repressor MetJ" in subsystem Methionine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>BNILDI_05705 met regulon transcriptional regulator MetJ (Escherichia coli ECRC62)
MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCE
AFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY