Protein Info for BNILDI_04140 in Escherichia coli ECRC62

Name: yicL
Annotation: carboxylate/amino acid/amine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details PF00892: EamA" amino acids 6 to 144 (139 residues), 71 bits, see alignment E=6.1e-24 amino acids 158 to 291 (134 residues), 80.7 bits, see alignment E=6.5e-27 TIGR00950: carboxylate/amino acid/amine transporter" amino acids 18 to 287 (270 residues), 261 bits, see alignment E=5.7e-82

Best Hits

Swiss-Prot: 100% identical to YICL_ECOLI: Uncharacterized inner membrane transporter YicL (yicL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3660)

Predicted SEED Role

"FIG00638098: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>BNILDI_04140 carboxylate/amino acid/amine transporter (Escherichia coli ECRC62)
MGSTRKGMLNVLIAAVLWGSSGVCAQYIMEQSQMSSQFLTMTRLIFAGLILLTLSFVHGD
KIFSIINNHKDAISLLIFSVVGALTVQLTFLLTIEKSNAATATVLQFLSPTIIVAWFSLV
RKSRPGILVFCAILTSLVGTFLLVTHGNPTSLSISPAALFWGIASAFAAAFYTTYPSTLI
ARYGTLPVVGWSMLIGGLILLPFYARQGTNFVVNGSLILAFFYLVVIGTSLTFSLYLKGA
QLIGGPKASILSCAEPLSSALLSLLLLGITFTLPDWLGTLLILSSVILISMDSRRRARKI
NRPARHE