Protein Info for BNILDI_04055 in Escherichia coli ECRC62

Name: dinD
Annotation: DNA damage-inducible protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF02498: Bro-N" amino acids 10 to 105 (96 residues), 41.1 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 84% identical to DIND_ECOLI: DNA damage-inducible protein D (dinD) from Escherichia coli (strain K12)

KEGG orthology group: K14623, DNA-damage-inducible protein D (inferred from 98% identity to ecf:ECH74115_5016)

Predicted SEED Role

"DNA-damage-inducible protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>BNILDI_04055 DNA damage-inducible protein D (Escherichia coli ECRC62)
MNEHHQPFEEIRHYGTEGQEFWSARELAPLLDYRDWRNFQKVLARATQACEASNQAASDH
FVETTKMVVLGSGAQRELEDVHLSRYACYLVVQNGDPAKPVIAAGQTYFAIQTRRQELAD
DEAFRQLREDEKRLFLRNELKEHNKQLVEAAQQAGVATAIDFAIFQNHGYRGLYGGLDQK
AIHQRKGLKKSQKILDHMGSTELAANLFRATQTEEKLKRDGVNSKQQANTTHFDVGSKVR
QTIQELGGTMPEELPTPQVSIKQLENSVKITEKK