Protein Info for BNILDI_04015 in Escherichia coli ECRC62

Name: radC
Annotation: DNA repair protein RadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 15 to 32 (18 residues), see Phobius details TIGR00608: DNA repair protein RadC" amino acids 9 to 222 (214 residues), 321.7 bits, see alignment E=1.2e-100 PF20582: UPF0758_N" amino acids 9 to 77 (69 residues), 74 bits, see alignment E=8.5e-25 PF04002: RadC" amino acids 103 to 221 (119 residues), 153 bits, see alignment E=3.4e-49

Best Hits

Swiss-Prot: 100% identical to YICR_ECO55: UPF0758 protein YicR (yicR) from Escherichia coli (strain 55989 / EAEC)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 99% identity to eco:b3638)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>BNILDI_04015 DNA repair protein RadC (Escherichia coli ECRC62)
VKNNSQLLMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLT
SEYEQFSGVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEER
EIFMVIFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEP
SKADKLITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI