Protein Info for BNILDI_03975 in Escherichia coli ECRC62

Name: rfaP
Annotation: lipopolysaccharide core heptose(I) kinase RfaP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF06293: Kdo" amino acids 20 to 230 (211 residues), 253.5 bits, see alignment E=6.8e-80

Best Hits

Swiss-Prot: 100% identical to RFAP_ECOLX: Lipopolysaccharide core heptose(I) kinase RfaP (rfaP) from Escherichia coli

KEGG orthology group: K02848, heptose (I) phosphotransferase [EC: 2.7.1.-] (inferred from 98% identity to ecm:EcSMS35_3965)

MetaCyc: 84% identical to lipopolysaccharide core heptose (I) kinase (Escherichia coli K-12 substr. MG1655)
RXN-22461 [EC: 2.7.1.235]; 2.7.1.235 [EC: 2.7.1.235]

Predicted SEED Role

"Lipopolysaccharide core biosynthesis protein WaaP (EC 2.7.-.-), heptosyl-I-kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-, 2.7.1.-

Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.1.235

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>BNILDI_03975 lipopolysaccharide core heptose(I) kinase RfaP (Escherichia coli ECRC62)
MVELKEPFATLWRGKDPFEEVKTLQGEVFRELETRRTLRFEMAGKSYFLKWHRGTTLKEI
IKNLLSLRMPVLGADREWNAIHRLRDVGVDTMYGVAFGEKGMNPLTRTSFIITEDLTPTI
SLEDYCADWATNPPDVRVKRMLIKRVATMVRDMHAAGINHRDCYICHFLLHLPFSGKEEE
LKISVIDLHRAQLRTRVPRRWRDKDLIGLYFSSMNIGLTQRDIWRFMKVYFAAPLKDILK
QEQGLLSQAEAKATKIRERTIRKSL