Protein Info for BNILDI_03290 in Escherichia coli ECRC62

Name: hdeD
Annotation: acid-resistance protein HdeD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 162 to 187 (26 residues), see Phobius details PF03729: DUF308" amino acids 27 to 97 (71 residues), 43.7 bits, see alignment E=1.3e-15 amino acids 84 to 153 (70 residues), 35.3 bits, see alignment E=5.5e-13

Best Hits

Swiss-Prot: 100% identical to HDED_ECO57: Protein HdeD (hdeD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b3511)

Predicted SEED Role

"Membrane transporter HdeD, H-NS repressed"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>BNILDI_03290 acid-resistance protein HdeD (Escherichia coli ECRC62)
MLYIDKATILKFDLEMLKKHRRAIQFIAVLLFIVGLLCISFPFVSGDILSTVVGALLICS
GIALIVGLFSNRSHNFWPVLSGFLVAVAYLLIGYFFIRAPELGIFAIAAFIAGLFCVAGV
IRLMSWYRQRSMKGSWLQLVIGVLDIVIAWIFLGATPMVSVTLVSTLVGIELIFSAASLF
SFASLFVKQQ