Protein Info for BNILDI_03080 in Escherichia coli ECRC62

Name: nikC
Annotation: nickel ABC transporter permease subunit NikC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 121 to 148 (28 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details TIGR02790: nickel ABC transporter, permease subunit NikC" amino acids 12 to 268 (257 residues), 398.3 bits, see alignment E=8.1e-124 PF00528: BPD_transp_1" amino acids 89 to 271 (183 residues), 111.4 bits, see alignment E=2.3e-36

Best Hits

Swiss-Prot: 100% identical to NIKC_ECOLI: Nickel transport system permease protein NikC (nikC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to eco:b3478)

MetaCyc: 100% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel transport system permease protein NikC (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>BNILDI_03080 nickel ABC transporter permease subunit NikC (Escherichia coli ECRC62)
VNFFLSSRWSVRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLG
RDIFSRLMAATRVSLGSVMACLLLVLTLGLVIGGSAGLIGGRVDQATMRVADMFMTFPTS
ILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVF
VDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPL
QMFWPGLALFISVMAFNLVGDALRDHLDPHLVTEHAH