Protein Info for BNILDI_02040 in Escherichia coli ECRC62

Name: panF
Annotation: sodium/pantothenate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details amino acids 392 to 416 (25 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details amino acids 449 to 467 (19 residues), see Phobius details TIGR02119: sodium/pantothenate symporter" amino acids 4 to 471 (468 residues), 758 bits, see alignment E=4.4e-232 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 36 to 432 (397 residues), 384.5 bits, see alignment E=6.8e-119 PF00474: SSF" amino acids 36 to 432 (397 residues), 485.6 bits, see alignment E=6e-150

Best Hits

Swiss-Prot: 100% identical to PANF_ECOLI: Sodium/pantothenate symporter (panF) from Escherichia coli (strain K12)

KEGG orthology group: K14392, sodium/pantothenate symporter (inferred from 100% identity to eco:b3258)

MetaCyc: 100% identical to pantothenate:Na+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-117

Predicted SEED Role

"Pantothenate:Na+ symporter (TC 2.A.21.1.1)" in subsystem Coenzyme A Biosynthesis (TC 2.A.21.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>BNILDI_02040 sodium/pantothenate symporter (Escherichia coli ECRC62)
MQLEVILPLVAYLVVVFGISVYAMRKRSTGTFLNEYFLGSRSMGGIVLAMTLTATYISAS
SFIGGPGAAYKYGLGWVLLAMIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARYQS
RLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYETGLLIFGISIALYTAFGGFRA
SVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVQTLQTIDPQLVTPQGADDILSPAFMT
SFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVIPD
LTVPDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIRPDQM
QNETRLKRMSAVITLVLGALLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERA
NAKGALSAMIVGGVLYAVLATLNIQYLGFHPIVPSLLLSLLAFLVGNRFGTSVPQATVLT
TDK