Protein Info for BNILDI_01870 in Escherichia coli ECRC62

Name: nanK
Annotation: N-acetylmannosamine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF00480: ROK" amino acids 4 to 288 (285 residues), 327.3 bits, see alignment E=5.3e-102

Best Hits

Swiss-Prot: 100% identical to NANK_ECO24: N-acetylmannosamine kinase (nanK) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K00885, N-acylmannosamine kinase [EC: 2.7.1.60] (inferred from 98% identity to eco:b3222)

MetaCyc: 98% identical to N-acetylmannosamine kinase (Escherichia coli K-12 substr. MG1655)
N-acylmannosamine kinase. [EC: 2.7.1.60]

Predicted SEED Role

"N-acetylmannosamine kinase (EC 2.7.1.60)" in subsystem Sialic Acid Metabolism (EC 2.7.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>BNILDI_01870 N-acetylmannosamine kinase (Escherichia coli ECRC62)
MTTLAIDIGGTKLAAALIGADGQIRDRRELPTPASQTPEALRDALSALVSPLQAHAQRVA
IASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTDLPTIAINDAQAAAWAEYQALEGD
VTEMVFITVSTGVGGGVVSGGKLLTGPGGLAGHIGHTLADPHGPVCGCGRTGCVEAIASG
RGIAAAAQGELAGADARTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVG
GSVGLAEGYLALVETYLAQEPAAFHVDLLAAHYRHDAGLLGAALLAQGEKL