Protein Info for BNILDI_00970 in Escherichia coli ECRC62

Name: yqiK
Annotation: Flotillin family inner membrane protein YqiK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details PF01145: Band_7" amino acids 39 to 195 (157 residues), 67 bits, see alignment E=2.2e-22 PF15975: Flot" amino acids 406 to 530 (125 residues), 138.9 bits, see alignment E=9.6e-45

Best Hits

Swiss-Prot: 99% identical to YQIK_ECOLI: Inner membrane protein YqiK (yqiK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecw:EcE24377A_3514)

Predicted SEED Role

"Inner membrane protein YqiK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>BNILDI_00970 Flotillin family inner membrane protein YqiK (Escherichia coli ECRC62)
MDDIVNSVPSWMFTAIIAVCILFIIGIIFARLYRRASAEQAFVRTGLGGQKVVMSGGAIV
MPIFHEIIPINMNTLKLEVSRSTIDSLITKDRMRVDVVVAFFVRVKPSVEGIATAAQTLG
QRTLSPEDLRMLVEDKFVDALRATAAQMTMHELQDTRENFVQGVQNTVAEDLSKNGLELE
SVSLTNFNQTSKEHFNPNNAFDAEGLTKLTQETERRRRERNEVEQDVEVAVREKNRDALS
RKLEIEQQEAFMTLEQEQQVKTRTAEQNARIAAFEAERRREAEQTRILAERQIQETEIER
EQAVRSRKVEAEREVRIKEIEQQQVTEIANQTKSIAIAAKSEQQSQAEARANLALAEAVS
AQQNVETTRQTAEADRAKQVALIAAAQDAETKAVELTVRAKAEKEAAEMQAAAIVELAEA
TRKKGLAEAEAQRALNDAINVLSDEQTSLKFKLALLQALPAVIEKSVEPMKSIDGIKIIQ
VDGLNRGSAAGDANTGNVGGGNLAEQALSAALSYRTQAPLIDSLLNEIGVSGGSLAALTS
PLTSTTPVAENVE