Protein Info for BACOVA_05573 in Bacteroides ovatus ATCC 8483

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 20 to 179 (160 residues), 153.3 bits, see alignment E=6.7e-49 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 21 to 179 (159 residues), 98.8 bits, see alignment E=2.5e-32 PF04542: Sigma70_r2" amino acids 25 to 91 (67 residues), 44.1 bits, see alignment E=2.9e-15 PF07638: Sigma70_ECF" amino acids 52 to 179 (128 residues), 28.7 bits, see alignment E=2.4e-10 PF08281: Sigma70_r4_2" amino acids 123 to 175 (53 residues), 54.7 bits, see alignment E=1.3e-18 PF04545: Sigma70_r4" amino acids 130 to 176 (47 residues), 28.1 bits, see alignment 2.3e-10

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 88% identity to bth:BT_4722)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>BACOVA_05573 RNA polymerase sigma-70 factor (Bacteroides ovatus ATCC 8483)
MVDSTDEKHLLIDLKGGSFQAFERLYNMYSGKLYNFIMRLSSGNQYMAEEVVQATFIRIW
EVHEKVDPASSFISFLCTIAKNLLMNMYQRQTVEYVYNEYLMKSSVDRDSQTEENIDLRF
LNEYIDSLAEELPAQRKKIFILSKRQNYTNKEIAEIMGISESTVATQLSLAVKFMREQLM
KHYDKVITLLLAFFVNEM