Protein Info for BACOVA_05483 in Bacteroides ovatus ATCC 8483

Annotation: TrkA N-terminal domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02254: TrkA_N
  • amino acids 3 to 118 (116 residues), 76.7 bits, E=1.9e-25
• PF03807: F420_oxidored
  • amino acids 4 to 72 (69 residues), 22.9 bits, E=1.1e-08

Best Hits

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 92% identity to bth:BT_4666)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Protein Sequence (228 amino acids)

>BACOVA_05483 TrkA N-terminal domain protein (Bacteroides ovatus ATCC 8483)
MKYIIIGLGNYGHVLAEELSALGHEIIGADISESRVDSIKDKVATAFVIDATDEQSLSVL
PLNSVDIVIVAIGENFGASIRVVALLKQKKVPRIFARAIDAVHKAVLEAFDLERILTPEE
DAARSLVQLLDFGTNMEGFRIDQDYYVVKFTVPEKFVGYFVNELNLDEEFHLKMIGLKRA
NKITNCLGISLTELHVKNELPENEKVEEGDELVCYGRYRDFQTFWKAI