Protein Info for BACOVA_05338 in Bacteroides ovatus ATCC 8483

Annotation: tRNA modification GTPase TrmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF10396: TrmE_N" amino acids 5 to 124 (120 residues), 141 bits, see alignment E=9.8e-45 TIGR00450: tRNA modification GTPase TrmE" amino acids 12 to 465 (454 residues), 387.7 bits, see alignment E=8.4e-120 PF12631: MnmE_helical" amino acids 127 to 462 (336 residues), 158.7 bits, see alignment E=1.2e-49 TIGR00231: small GTP-binding protein domain" amino acids 222 to 381 (160 residues), 83.8 bits, see alignment E=1.1e-27 PF01926: MMR_HSR1" amino acids 223 to 338 (116 residues), 95.4 bits, see alignment E=1.2e-30 PF00071: Ras" amino acids 223 to 383 (161 residues), 23.2 bits, see alignment E=2.3e-08 PF02421: FeoB_N" amino acids 223 to 380 (158 residues), 37.3 bits, see alignment E=9.8e-13

Best Hits

Swiss-Prot: 92% identical to MNME_BACTN: tRNA modification GTPase MnmE (mnmE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 92% identity to bth:BT_4551)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>BACOVA_05338 tRNA modification GTPase TrmE (Bacteroides ovatus ATCC 8483)
MIQDTICAIATAQGGAIGNIRVSGPEAISITGSIFKPAKAGKLLSEQKPYTLTFGRIYDG
DEMIDEVLVSLFRTPHSYTGEDSTEITCHGSTYILQQVMQLLIKNGCRMAQPGEYTQRAF
LNGKMDLSQAEAVADLIASSSAATHRLAMSQMRGGFSKELTDLRNKLLNFTSMIELELDF
SEEDVEFADRSALRKLADEIEQVISRLAHSFSVGNAIKNGVPVAIIGETNAGKSTLLNVL
LNEDKAIVSDIHGTTRDVIEDTVNIGGITFRFIDTAGIRETNDTIESLGIERTFQKLDQA
EIVLWMVDAVNAASQIEQLSEKIIPRCEGKHLIVVFNKADLIEGKQKEDLLSLLKDFPKE
STESIFISAKQRENTSELQKMLIDAAHLPTVTQNDIIVTNVRHYEALNKALEAIHRVQNG
LDSQISGDFLSQDIRECIFFISDIAGEVTNDMVLQNIFQHFCIGK