Protein Info for BACOVA_05266 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 119 to 135 (17 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 347 to 370 (24 residues), see Phobius details PF04235: DUF418" amino acids 227 to 389 (163 residues), 145.9 bits, see alignment E=5.8e-47

Best Hits

KEGG orthology group: None (inferred from 88% identity to bth:BT_4459)

Predicted SEED Role

"conserved hypothetical protein, putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>BACOVA_05266 hypothetical protein (Bacteroides ovatus ATCC 8483)
MTQTLKTSERLGVVDALRGFALLAIVLLHNLEHYNLFFIPENMPAWLQTIDKYAWDTMFF
LFAGKAYATFSLLFGFSFYIQFHNAEKRGIDFRGRFAWRLCLLFLFAQLHALFYNGDILL
LYAVVGFALIPVCKLKDKTVFWIALILLLQPYEWGRAVYAMINPDYVAVTGHCVPYAIRA
QEATLNGNFLEVLRSNIIDGQLYSNIWQVENGRLFQTAALFMFGMLLGRRKYLIKNEESV
CFWKKMLIGAILAFIPLYCLKTFVPDLLTNPSIQVPYNIAVPSYANFAFMIILVSIFTLL
WFKKEKGYSWQSLLIPYGRMSLTNYISQSIMGVTIYYGFGLAMYKYAGATASLLIALLIF
TVQLIFSRWWLARHKQGPLEFLWRKGTWI