Protein Info for BACOVA_05115 in Bacteroides ovatus ATCC 8483

Annotation: HAD hydrolase, family IA, variant 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF00702: Hydrolase" amino acids 3 to 179 (177 residues), 89.9 bits, see alignment E=5.7e-29 PF12710: HAD" amino acids 7 to 175 (169 residues), 33.1 bits, see alignment E=1.5e-11 PF13419: HAD_2" amino acids 7 to 185 (179 residues), 143.8 bits, see alignment E=1.3e-45 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 80 to 179 (100 residues), 37.8 bits, see alignment E=2.4e-13 PF13242: Hydrolase_like" amino acids 141 to 209 (69 residues), 47.9 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 86% identity to bth:BT_4315)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>BACOVA_05115 HAD hydrolase, family IA, variant 1 (Bacteroides ovatus ATCC 8483)
MNYKTYLFDFDYTLADSSRGIVKCFRIVLTRHQYLTVTDEAIKRTIGKTLEESFSILTGI
TDPAQLEAFRQEYRLEADVHMNVNTRLFPDTLSTLKELKKRGARVGIISTKYRFRILSYL
EEYLPKDFLDIVVGGEDVKAPKPSPEGVKFALEHLGSSPEETLYIGDSTVDAETAQNAGV
DFAGVLNGMTTAEELRVYPHKIIMQNLGELVQ