Protein Info for BACOVA_04459 in Bacteroides ovatus ATCC 8483

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 282 (282 residues), 345.1 bits, E=5.6e-107
• TIGR01214: dTDP-4-dehydrorhamnose reductase
  • amino acids 2 to 281 (280 residues), 313.5 bits, E=5.6e-98
• PF01370: Epimerase
  • amino acids 3 to 200 (198 residues), 78.2 bits, E=1.3e-25
• PF16363: GDP_Man_Dehyd
  • amino acids 30 to 148 (119 residues), 49.9 bits, E=6.6e-17
• PF02719: Polysacc_synt_2
  • amino acids 36 to 158 (123 residues), 24.3 bits, E=3.4e-09

Best Hits

Swiss-Prot: 42% identical to RMLD_ECOLI: dTDP-4-dehydrorhamnose reductase (rfbD) from Escherichia coli (strain K12)

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 90% identity to bth:BT_1730)

MetaCyc: 41% identical to dTDP-4,6-dihydroxy-2-methyloxan-3-one 4-ketoreductase (Streptomyces antibioticus)
1.1.1.-

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• O-antigen building blocks biosynthesis (E. coli) (8/11 steps found)
• dTDP-β-L-olivose biosynthesis (4/7 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (4/23 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (11/33 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.133

Use Curated BLAST to search for 1.1.1.133

Protein Sequence (286 amino acids)

>BACOVA_04459 dTDP-4-dehydrorhamnose reductase (Bacteroides ovatus ATCC 8483)
MRILVTGANGQLGNEMQVLAKENPQHTYYFTDVEELNICDKQAVWAYIAEKRIELVVNCA
AYTAVDKAEDNSELAYQLNCEAPKQLASAAQFNGAAMIQVSTDYVFDGTAHTPYTEDCDP
CPDSVYGTTKLEGEYDVMNYCEKAVVIRTAWLYSTFGNNFVKTMIRLGKERDSLGVVFDQ
IGTPTYANDLARAIYTIINKGIVRGIYHFSNEGVCSWYDFTVAIHRLAGITSCKVKPLHT
AEYPAKANRPAYSVLDKTKIKTTFGIEIPHWEESLQRCLEKLEIKN