Protein Info for BACOVA_04271 in Bacteroides ovatus ATCC 8483

Annotation: efflux ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 340 to 365 (26 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details PF12704: MacB_PCD" amino acids 20 to 244 (225 residues), 72.1 bits, see alignment E=8.2e-24 PF02687: FtsX" amino acids 289 to 418 (130 residues), 77.4 bits, see alignment E=9.4e-26

Best Hits

KEGG orthology group: None (inferred from 67% identity to bvu:BVU_2349)

Predicted SEED Role

"Macrolide-specific ABC-type efflux carrier (TC 3.A.1.122.1)" (TC 3.A.1.122.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>BACOVA_04271 efflux ABC transporter, permease protein (Bacteroides ovatus ATCC 8483)
MWKQYIKQALYQLKENRLISIVCMVGTALAICMIMVIVLTLQIRIKDCVPEVNRSRSLYV
KAMTSRHKEQHNNAASSQMSVTTARECFKTLTIPEAVTITSVNNKMRASLPGGGRMSVDE
METDEAFWQVFCFEFLCGKPYTKADFESGLSKAVVSASVARHLFGTTDVVGRTIQLNKAD
YTITGVVKDVSKLATASYAQVWIPYTSTDLASFSWRENLMGPMRAVILARSSDDFPAIRA
EVEKYRQVYNSKLKDMELIYRGQPDTQFAYLYRHWGTDLDMKHIVRRFILIIVILLLVPA
INLSSMTLSRMRKRMTEIGVRKAFGATANELLRQVFWENLILTLLAGILGLILSYSATFL
LNSFLFDNSENAGLAGETSLSTDMLFSPLTFLVAFCFCLLLNLLSAGIPAWRVSRMNIVD
AINQR