Protein Info for BACOVA_04194 in Bacteroides ovatus ATCC 8483

Annotation: efflux ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 806 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 333 to 360 (28 residues), see Phobius details amino acids 380 to 405 (26 residues), see Phobius details amino acids 429 to 451 (23 residues), see Phobius details amino acids 680 to 706 (27 residues), see Phobius details amino acids 727 to 752 (26 residues), see Phobius details amino acids 769 to 791 (23 residues), see Phobius details PF12704: MacB_PCD" amino acids 20 to 239 (220 residues), 90 bits, see alignment E=2.6e-29 amino acids 462 to 641 (180 residues), 37.9 bits, see alignment E=2.3e-13 PF02687: FtsX" amino acids 291 to 409 (119 residues), 52.2 bits, see alignment E=5.8e-18 amino acids 686 to 795 (110 residues), 53.2 bits, see alignment E=3e-18

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 92% identity to bth:BT_1465)

Predicted SEED Role

"putative ABC transporter permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (806 amino acids)

>BACOVA_04194 efflux ABC transporter, permease protein (Bacteroides ovatus ATCC 8483)
MIGNYWNSAYRNLMKRKKFSFINIFGLAIGMASALLMLTYVTFEFSFDKMHTKYAHIYRV
QSTFHEGEVLTDYWATSSFGYASAMKENLAGIEDYTRIATHLQPEQIVKYGELTLRENQI
AYADPGFFRLFDFELLKGDKKTCLSMPRQVVITERIARKYFKDEDPIGKILIFTGTYDKV
SCEVTGVMKEMPSNSHIHYNFLISYASLPQYMQEYWYKHEAYTYVLLDSPERKAEIEKEF
PVMAEKYKTEEALKNKTWGVSLIPLADIHLTPQIGYETETKGNRSAMIALIFAAVAILVI
AWINYINLTVARSMERAKEVGVRRVVGAFRQQLIYQFLFEALVMNLIAFILAVGLIELVL
PHFNQLVGRTVTFSVWFMDYWWILLVLVFIAGIFISGYYPALALLNRKPITLLKGKFLHS
KSGDRTRQVLVVVQYTASMILLCVTLIVFAQLNFMRNQSLGVKTSQTLVVKFPGHTEGQN
IKLEAMKKAIARLPLVHRVTFSGAVPGEEVATFLSNRRTNDALKQNRLYEMLACDPDYAD
AYGLQIVAGRSFSEEYGDDVDKLVINETAVRNLGFASNDEAIGELVTVECTDAPMQIIGV
VKDYHQQALSKNYTPIMLIHKDKIDWLPQRYISVVMASGNPRELVSQVQEIWNQYFADSS
FDYFFLDQFFDHQYRQDEVFGAMIGSFTGLAIFISCLGLWVLVMFSCSTRTKEMGIRKVL
GASRWNLFYQLVKGFFQLILIAVVIALPVAWFSMNAWLSHYAFRTDLKAWFFIVPVLLML
FISFVTVAFQTMKIIMSKPARSLRYE