Protein Info for BACOVA_03809 in Bacteroides ovatus ATCC 8483

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 62 to 87 (26 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 21 to 287 (267 residues), 75.3 bits, see alignment E=6.7e-25 PF00005: ABC_tran" amino acids 356 to 505 (150 residues), 99.5 bits, see alignment E=2.6e-32

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 66% identity to mpi:Mpet_0451)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (590 amino acids)

>BACOVA_03809 ABC transporter, ATP-binding protein (Bacteroides ovatus ATCC 8483)
MSTLKKLQNYMGKRKVLLPAAMLLSALSALAGMLPYILIWLIVRELLEHGEITSSGNVVT
YAWWAAGMAVASIVLYFAALMSSHLAAFRVESNLRKEAMRQIVRMPLGFFDINTSGRIRK
IIDDNAGVTHSFLAHQLPDLAATFLVPLVAAILIFVFDWILGLACIVPVIIAMLVMGFMM
NAEGRQFMKSYMTSLEEMNTEAVEYVRGIPVVKVFQQTIYSFKNFHRCIMNYNKMVFGYT
RMWEKPMSLYTVIINGFVFFLAPLAILLIGYSGNYASVLLNFFLFVLITPVFSQSIMKSM
YLNQALGQASEAIGRLENLVAYEHLTVVEHPQPVKEFSIQFEKVSFSYPGANQKAVDDVS
FTIPQGNTVALVGASGGGKTTIARLVPRFWEATEGKVLIGGINVREIAPEELMKYISFVF
QNTKLFKTSLLENIKYGNPDATMEEVERAVDMAQCREIINKLPLGLNTKIGTEGTYLSGG
EQQRIVLARAILKNAPIIVLDEATAFADPENEHLIQQALKELTKGKTVLMIAHRLSSITD
ADNILVIDKGKIAEQGTHANLLGKQGIYYHMWNEYQQSVRWTIGKEVSND