Protein Info for BACOVA_03587 in Bacteroides ovatus ATCC 8483

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 89 to 107 (19 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details PF03446: NAD_binding_2" amino acids 2 to 71 (70 residues), 25.8 bits, see alignment E=1.5e-09 PF03807: F420_oxidored" amino acids 2 to 96 (95 residues), 75.2 bits, see alignment E=7.9e-25 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 3 to 256 (254 residues), 222.2 bits, see alignment E=4.5e-70 PF14748: P5CR_dimer" amino acids 159 to 256 (98 residues), 113.5 bits, see alignment E=8.4e-37

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 90% identity to bth:BT_3757)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.2

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>BACOVA_03587 pyrroline-5-carboxylate reductase (Bacteroides ovatus ATCC 8483)
MKIAIIGAGNMGGSIARGLAKGSLIDDSDIIVSNPSAGKLEKLKKEFPGISTTNNNLEAA
TGADIVILAVKPWFMESVMRELKLKSKQILISVAAGISFEELAHYVVAPEMPMFRLIPNT
AISELESMTLVAARNTNDEQDNFILRLFSEMGTVMLIPEDKIAAATALASCGIAYVLKYI
QAAMQAGIEMGLRPKDAMQMIAQSLKGAAALIQNNDTHPSVEIDKVTTPGGITIKGINEL
EHNGFTSAIIKAMKASK